PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G24130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 121aa    MW: 13439.3 Da    PI: 4.7714
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G24130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB168.76.8e-5322113293
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                      +eqdrflPian++rim++++P+n+ki+kd+ke+vqecvsefisf+tseasdkc +ekrktingddl+w+++tlGfedyveplk+yl+ yre+
  OPUNC05G24130.1  22 KEQDRFLPIANIGRIMRRAVPENGKIAKDSKESVQECVSEFISFITSEASDKCLKEKRKTINGDDLIWSMGTLGFEDYVEPLKLYLRLYREV 113
                      89****************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-4621113IPR009072Histone-fold
SuperFamilySSF471138.07E-3624113IPR009072Histone-fold
PfamPF008085.2E-262791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.4E-195573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.4E-197492No hitNo description
PRINTSPR006153.4E-1993111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MSEGFDGTEN GSGGGGGGGV GKEQDRFLPI ANIGRIMRRA VPENGKIAKD SKESVQECVS  60
EFISFITSEA SDKCLKEKRK TINGDDLIWS MGTLGFEDYV EPLKLYLRLY REVYSIYILI  120
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-4622112393NF-YB
4awl_B4e-4622112494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-4622112494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8379751e-162CT837975.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA013H22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638071.11e-65PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotQ65XK12e-67NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0E0L6031e-83A0A0E0L603_ORYPU; Uncharacterized protein
STRINGBGIOSGA020407-PA2e-75(Oryza sativa Indica Group)
STRINGORGLA05G0230300.11e-75(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.82e-54nuclear factor Y, subunit B1